PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn235741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 856aa    MW: 94851.3 Da    PI: 6.7576
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn235741genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-4073150178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqve+C adl++ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Achn235741  73 VCQVEDCPADLTTAKDYHRRHKVCDMHSKASKALVGKVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 150
                 6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3168135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.69371148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3772153IPR004333Transcription factor, SBP-box
PfamPF031108.9E-2974147IPR004333Transcription factor, SBP-box
SuperFamilySSF484039.02E-9574732IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.6E-6638736IPR020683Ankyrin repeat-containing domain
CDDcd002048.76E-9639728No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 856 aa     Download sequence    Send to blast
MNLENDKGKR ELEKRRRVVV VEDQYLNDVA AGSLNFKLGG QVYPIIQTEM EKWEEGKSGK  60
KSKVVASTSH HAVCQVEDCP ADLTTAKDYH RRHKVCDMHS KASKALVGKV MQRFCQQCSR  120
FHVLQEFDEG KRSCRRRLAG HNRRRRKTHP ESVVNGGSLN DERGSSYVLM DDCIDIQDPP  180
RPIGLCSTVS AFEWTEMRTS TVNACGGNLQ TPPTNPCTAK GSNPATASRP GAAVGRMKLN  240
DIDLNNIYDD TQDCAENMEN CGAPLNLGTG SLDHTTRGHQ DCLNSSLPQT SGNSGSTSSQ  300
SPSTSSGEAQ DLYSDLLFLT NSQCRMDLIV FKLFGKDPSD FPLVLRRQIL DWLSHSPSDI  360
ESYIRPGCII LTIYLRLGKS TWEEVFFIRF IAVTFLYRLS VISNPASCQV VLETSLPLTS  420
HKNCKILSIK PIAVSVSDSA QFLVKGFNLS RPTTRLLCAL EGKYLMQESC SDVTEGGDTF  480
IDQDAIQCLR FSCSIPNLTG RGFIEVEDHD LSGSFFPFIV TEPDVCSEIC MLESAIEVAE  540
IADDVQPESE QIKARNSALD FINEMGWLLH RSQVKCRLDP TNPDLNLFPF ERFSWLMEFS  600
VEHNWCAVVK KLLGILFNGS VDSGEHPSVE LALLEMCLLH RAVRRNCISM VEFLLRYIPD  660
GASNFLFNSD AIGAGGLTPL HIAASRDASE SVLDALTNDP GLVGIKAWKG ACDSAGLTPN  720
DYACLRGYYS YSRLVQKKID QKLGNGHVLL DIPCALLQCG NIKQKPVAEV ANFHTEKTGM  780
KPIQQQHCRL CEQKMLSYGS SNTTRTSVAI YRPAMLSMVA IAAVCVCVAL LFKSSPEVLY  840
IFRPFRWELL KYGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-30731471084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11317KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008390368.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A067K9350.0A0A067K935_JATCU; Uncharacterized protein
STRINGPGSC0003DMT4000698260.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-165squamosa promoter binding protein-like 1